Structure of PDB 8wb4 Chain E Binding Site BS01

Receptor Information
>8wb4 Chain E (length=77) Species: 173977 (Chroomonas placoidea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GERPFSDIITSIRYWIIHSITIPALYVAGWLFVSTGLAYDIFGTPRPNEY
FTQDRQQVPLVNDRFSAKQELEDLTKG
Ligand information
>8wb4 Chain R (length=26) Species: 173977 (Chroomonas placoidea) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wb4 Structure and distinct supramolecular organization of a PSII-ACPII dimer from a cryptophyte alga Chroomonas placoidea.
Resolution2.47 Å
Binding residue
(original residue number in PDB)		E8 F11 I28 Y32
Binding residue
(residue number reindexed from 1)		E2 F5 I22 Y26
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wb4, PDBe:8wb4, PDBj:8wb4
PDBsum8wb4
PubMed38806516
UniProtA0A222AI74

[Back to BioLiP]