Structure of PDB 8umv Chain E Binding Site BS01

Receptor Information
>8umv Chain E (length=348) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTR
IMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAG
NSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRT
MEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCK
KEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDW
EVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLH
NCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8umv Cryo-EM reveals a nearly complete PCNA loading process and unique features of the human alternative clamp loader CTF18-RFC.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		N102 R105
Binding residue
(residue number reindexed from 1)		N101 R104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003689 DNA clamp loader activity
GO:0005515 protein binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0017116 single-stranded DNA helicase activity
Biological Process
GO:0000731 DNA synthesis involved in DNA repair
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006271 DNA strand elongation involved in DNA replication
GO:0006281 DNA repair
GO:0032508 DNA duplex unwinding
GO:0046683 response to organophosphorus
GO:1900264 positive regulation of DNA-directed DNA polymerase activity
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005663 DNA replication factor C complex
GO:0031390 Ctf18 RFC-like complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8umv, PDBe:8umv, PDBj:8umv
PDBsum8umv
PubMed38669181
UniProtP40938|RFC3_HUMAN Replication factor C subunit 3 (Gene Name=RFC3)

[Back to BioLiP]