Structure of PDB 8u77 Chain E Binding Site BS01

Receptor Information
>8u77 Chain E (length=67) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLYS
LPEGLLKSLWDYVKKNT
Ligand information
>8u77 Chain F (length=10) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EPKLLLKINL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8u77 Molecular insight into interactions between the Taf14, Yng1 and Sas3 subunits of the NuA3 complex.
Resolution1.93 Å
Binding residue
(original residue number in PDB)		L186 G218 E219 F220 I221 I222 Y225
Binding residue
(residue number reindexed from 1)		L10 G42 E43 F44 I45 I46 Y49
External links
PDB RCSB:8u77, PDBe:8u77, PDBj:8u77
PDBsum8u77
PubMed38914563
UniProtP35189|TAF14_YEAST Transcription initiation factor TFIID subunit 14 (Gene Name=TAF14)

[Back to BioLiP]