Structure of PDB 8tof Chain E Binding Site BS01

Receptor Information
>8tof Chain E (length=253) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPEEIINGKCFFIHYQGWK
SSWDEWVGYDRIRAYNEENIAMKKRLANEAKEAKKSLLEQQKKKKLISLQ
IPIKLKSVLVDDWEYVTKDKKICRLPADVTVEMVLNKYEHEVSQELESPG
SQSQLSEYCAGLKLYFDKCLGNMLLYRLERLQYDELLKKSSKDQKPLVPI
RIYGAIHLLRLISVLPELISSTTMDLQSCQLLIKQTEDFLVWLLMHVDEY
FND
Ligand information
>8tof Chain T (length=176) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agatcacgcgcgatatcagaatcccggtgccgaggccgctcaattggtcg
tagacagctctagcaccgcttaaacgcacgtacgcgctgtcccccgcgtt
ttaaccgccaaggggattactccctagtctcctggcacgagacagaaaaa
aacaacgaaaacggccaccacccaga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tof Structure of the complete Saccharomyces cerevisiae Rpd3S-nucleosome complex.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		H80 Q82 G83 W84 K85 K130
Binding residue
(residue number reindexed from 1)		H45 Q47 G48 W49 K50 K95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0035064 methylated histone binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006335 DNA replication-dependent chromatin assembly
GO:0006337 nucleosome disassembly
GO:0006338 chromatin remodeling
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:0009889 regulation of biosynthetic process
GO:0030174 regulation of DNA-templated DNA replication initiation
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0043487 regulation of RNA stability
GO:0045892 negative regulation of DNA-templated transcription
GO:0060195 negative regulation of antisense RNA transcription
Cellular Component
GO:0000123 histone acetyltransferase complex
GO:0005634 nucleus
GO:0032221 Rpd3S complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:1990453 nucleosome disassembly/reassembly complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8tof, PDBe:8tof, PDBj:8tof
PDBsum8tof
PubMed38065958
UniProtQ12432|EAF3_YEAST Chromatin modification-related protein EAF3 (Gene Name=EAF3)

[Back to BioLiP]