Structure of PDB 8ti7 Chain E Binding Site BS01

Receptor Information
>8ti7 Chain E (length=131) Species: 6956 (Dermatophagoides pteronyssinus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGSWQSYVDNQICQHVDCTLAAIANIQDGSIWAKFEKDDKKISPKELKTI
ADTIRQNPNGFLETGIHIGGEKYICIQADNQLVRGRRGSSALCIVATNTC
LLAAATVDGYPAGQLNNVIEKLGDYLRSNNY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ti7 Structural homology of mite profilins to plant profilins is not indicative of allergic cross-reactivity.
Resolution2.397 Å
Binding residue
(original residue number in PDB)		N129 Y130
Binding residue
(residue number reindexed from 1)		N130 Y131
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0003785 actin monomer binding
Biological Process
GO:0042989 sequestering of actin monomers
GO:0044087 regulation of cellular component biogenesis
GO:0051128 regulation of cellular component organization
Cellular Component
GO:0005856 cytoskeleton
GO:0005938 cell cortex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ti7, PDBe:8ti7, PDBj:8ti7
PDBsum8ti7
PubMed38662449
UniProtA0A2L0EBJ5

[Back to BioLiP]