Structure of PDB 8t56 Chain E Binding Site BS01

Receptor Information
>8t56 Chain E (length=36) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FAEKFKEAVKDYFAKFWDPAAEKLKEAVKDYFAKLW
Ligand information
>8t56 Chain F (length=25) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FAKFWDPAAEKLKEAVKDYFAKLWD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t56 Structure of mechanically activated ion channel OSCA2.3 reveals mobile elements in the transmembrane domain.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K6 V9 K10 W17 E22 K25 K29
Binding residue
(residue number reindexed from 1)		K6 V9 K10 W17 E22 K25 K29
External links