Structure of PDB 8smo Chain E Binding Site BS01

Receptor Information
>8smo Chain E (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLGSQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPE
SLRSKVDEAVAVLQAHQAKEAAQK
Ligand information
>8smo Chain F (length=20) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SNLNPNAPEFHPGVPWKGLQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8smo Crystal structure of the complex between truncated MLLE domain of PABPC1 and engineered superPAM2 peptide
Resolution3.0 Å
Binding residue
(original residue number in PDB)		G563 E564 F567 G579 K580 T582 G583 M584 L586 E587 E609 L614
Binding residue
(residue number reindexed from 1)		G12 E13 F16 G28 K29 T31 G32 M33 L35 E36 E58 L63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:8smo, PDBe:8smo, PDBj:8smo
PDBsum8smo
PubMed
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]