Structure of PDB 8siy Chain E Binding Site BS01

Receptor Information
>8siy Chain E (length=108) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPN
IQSVLLPK
Ligand information
>8siy Chain K (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcctggagaatcccggtgccgaggccgctcaattggtcgtagacagctct
agcaccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaa
ggggattactccctagtctccaggcacgtgtcagatatatacatcct
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8siy A dual role for the chromatin reader ORCA/LRWD1 in targeting the origin recognition complex to chromatin.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		A14 R17 R20 R32 R42 R77
Binding residue
(residue number reindexed from 1)		A4 R7 R10 R22 R32 R67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8siy, PDBe:8siy, PDBj:8siy
PDBsum8siy
PubMed37551430
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]