Structure of PDB 8s52 Chain E Binding Site BS01

Receptor Information

>8s52 Chain E (length=209) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEG
RPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITR
ALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVM
TKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAG
RYITYRLVQ

Ligand information

>8s52 Chain N (length=53) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaaggggggctataaaagggggtgggggcggcaattttgacagcgagggc
cag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8s52 Three-step mechanism of promoter escape by RNA polymerase II
Resolution	2.9 Å
Binding residue (original residue number in PDB)	G83 I84 T111 S113
Binding residue (residue number reindexed from 1)	G82 I83 T110 S112

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0001054	RNA polymerase I activity
GO:0001055	RNA polymerase II activity
GO:0001056	RNA polymerase III activity
GO:0003677	DNA binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006362	transcription elongation by RNA polymerase I
GO:0006366	transcription by RNA polymerase II
GO:0042797	tRNA transcription by RNA polymerase III

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005665	RNA polymerase II, core complex
GO:0005666	RNA polymerase III complex
GO:0005736	RNA polymerase I complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8s52, PDBe:8s52, PDBj:8s52
PDBsum	8s52
PubMed	38604172
UniProt	I3LSI7

[Back to BioLiP]