Structure of PDB 8rt8 Chain E Binding Site BS01

Receptor Information
>8rt8 Chain E (length=246) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDVPSSSRYDHRIRYVTYNPADVVQVDTVLGVATHIMLEEGEQYLTHAFG
DSEAYAFARKGRHIFIKPQAELANTNLIVVTDRRSYKFRLQMRNDRNGAM
YELAFRYPDTQARQTREANARAAVEAAFEQRVGAYYNLKYMMSGDKDIAP
VNAWDDGRFTYFKFSANADLPSIYFVDAEGNESLVPRTTVGSSNNIIAVH
KVNPKWMIRLGNRALAIFNEAYDPNGVPNDTGTASPAVRRVNKGGN
Ligand information
>8rt8 Chain F (length=28) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CASAPKPKQPSDFNREPVNKTVPVEIQR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rt8 Cryo-EM structure of a conjugative type IV secretion system suggests a molecular switch regulating pilus biogenesis.
Resolution3.05 Å
Binding residue
(original residue number in PDB)
Y156 L158 Y160 M161 M162 S163 D165 K166 N172 A173 W174 K183 I216 M227 R229 F238
Binding residue
(residue number reindexed from 1)
Y136 L138 Y140 M141 M142 S143 D145 K146 N152 A153 W154 K163 I196 M207 R209 F218
External links