Structure of PDB 8rc0 Chain E Binding Site BS01

Receptor Information
>8rc0 Chain E (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKDDEEADAIYAALDKRMDERRKERREQREKEEKIQQQFSDLKRKLAEVT
EEEWLSIPEV
Ligand information
>8rc0 Chain 5 (length=104) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acucugguuucucuucagaucgcauaaaucuuucgcacuaaagauuuccg
uggagaggaacaacucugaguccaauuuuuugaggccuugcuuuggcaag
gcua
<<<<.<<<<<<<<<<<<........<<<<<<<<......>>>>>>>>...
>>>>>>>>>>>....>.>>>>............<<<<<<<<....>>>>>
>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rc0 Structure of the human 20S U5 snRNP.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R116 R119 R120 R123
Binding residue
(residue number reindexed from 1)		R22 R25 R26 R29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0043021 ribonucleoprotein complex binding
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000245 spliceosomal complex assembly
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0006403 RNA localization
GO:0008380 RNA splicing
GO:0045944 positive regulation of transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0016020 membrane
GO:0016607 nuclear speck
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rc0, PDBe:8rc0, PDBj:8rc0
PDBsum8rc0
PubMed38467877
UniProtO94906|PRP6_HUMAN Pre-mRNA-processing factor 6 (Gene Name=PRPF6)

[Back to BioLiP]