Structure of PDB 8oev Chain E Binding Site BS01

Receptor Information
>8oev Chain E (length=209) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEG
RPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITR
ALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVM
TKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAG
RYITYRLVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oev Structure of transcribing RNA polymerase II-Elongin complex
Resolution2.86 Å
Binding residue
(original residue number in PDB)		I84 T111 S113
Binding residue
(residue number reindexed from 1)		I83 T110 S112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001054 RNA polymerase I activity
GO:0001055 RNA polymerase II activity
GO:0001056 RNA polymerase III activity
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006362 transcription elongation by RNA polymerase I
GO:0006366 transcription by RNA polymerase II
GO:0042797 tRNA transcription by RNA polymerase III
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005665 RNA polymerase II, core complex
GO:0005666 RNA polymerase III complex
GO:0005736 RNA polymerase I complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oev, PDBe:8oev, PDBj:8oev
PDBsum8oev
PubMed37932450
UniProtI3LSI7

[Back to BioLiP]