Structure of PDB 8odt Chain E Binding Site BS01

Receptor Information
>8odt Chain E (length=230) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAE
AFEDKFWSGIELSRLYQESQGKRDNLTGSEQIFYSGFKEFVRLHRANSHA
PEAVVEGASRAMRISMNRELENLETHIPFLGTVGSISPYIGLFGTVWGIM
HAFIALGAVKQATLQMVAPGIAEALIATAIGLFAAIPAVMAYNRLNQRVN
KLELNYDNFMEEFTAILHRQAFTVSESNKG
Ligand information
>8odt Chain F (length=21) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
INIVPLLDVLLVLLLIFMATA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8odt Tuneable force-transduction in the bacterial periplasm
Resolution4.2 Å
Binding residue
(original residue number in PDB)		L164 I171
Binding residue
(residue number reindexed from 1)		L164 I171
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0017038 protein import
GO:0043213 bacteriocin transport
GO:0051301 cell division
GO:0090529 cell septum assembly
GO:1905153 regulation of membrane invagination
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030313 cell envelope
GO:0032153 cell division site

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8odt, PDBe:8odt, PDBj:8odt
PDBsum8odt
PubMed37972066
UniProtP0ABU9|TOLQ_ECOLI Tol-Pal system protein TolQ (Gene Name=tolQ)

[Back to BioLiP]