Structure of PDB 8kcc Chain E Binding Site BS01

Receptor Information
>8kcc Chain E (length=98) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>8kcc Chain I (length=150) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcctggagaatcccggtgccgaggccgctcaattggtcgtagacagctc
tagcaccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgcca
aggggattactccctagtctccaggcacgtgtcacatatatacatcctgt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kcc Mechanism of heterochromatin remodeling revealed by the DDM1 bound nucleosome structures.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R42 T45 R72 R83 F84 Q85 R116 V117 T118 M120
Binding residue
(residue number reindexed from 1)		R5 T8 R35 R46 F47 Q48 R79 V80 T81 M83
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009536 plastid
GO:0010369 chromocenter

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8kcc, PDBe:8kcc, PDBj:8kcc
PDBsum8kcc
PubMed38870940
UniProtP59226|H31_ARATH Histone H3.1 (Gene Name=HTR2)

[Back to BioLiP]