Structure of PDB 8j92 Chain E Binding Site BS01

Receptor Information
>8j92 Chain E (length=97) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>8j92 Chain I (length=149) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccaggcctgagaatccggtgccgaggccgctcaattggtcgtagacagct
ctagcaccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgcc
aaggggattactccctagtctccaggcacgtgtcagatatatacatccg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j92 Molecular and structural basis of the chromatin remodeling activity by Arabidopsis DDM1.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R40 R42 R72 R83 F84 T118
Binding residue
(residue number reindexed from 1)		R2 R4 R34 R45 F46 T80
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009536 plastid
GO:0010369 chromocenter

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8j92, PDBe:8j92, PDBj:8j92
PDBsum8j92
PubMed38992002
UniProtP59226|H31_ARATH Histone H3.1 (Gene Name=HTR2)

[Back to BioLiP]