Structure of PDB 8i17 Chain E Binding Site BS01

Receptor Information
>8i17 Chain E (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i17 Structural basis for H2A-H2B recognitions by human Spt16.
Resolution1.98 Å
Binding residue
(original residue number in PDB)		S38 Y42 I54 S55 S56 K57
Binding residue
(residue number reindexed from 1)		S5 Y9 I21 S22 S23 K24
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8i17, PDBe:8i17, PDBj:8i17
PDBsum8i17
PubMed36801613
UniProtP06899|H2B1J_HUMAN Histone H2B type 1-J (Gene Name=H2BC11)

[Back to BioLiP]