Structure of PDB 8i0p Chain E Binding Site BS01

Receptor Information
>8i0p Chain E (length=299) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PIMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKG
HSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSC
YPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQ
IISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDN
TVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADR
FVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEI
Ligand information
>8i0p Chain B (length=98) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguuucucuucagaucgcauaaaucuuucgccuuuuacuaaagauuuccg
uggagaggaacaaccccaauuuuuugaggccuugcuuuggcaaggcua
.<<<<<<<<<<<........<<<<<<<<.<.......>.>>>>>>>>...
>>>>>>>>>>>................<<<<<<<<....>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i0p Molecular Basis for the activation of Human spliceosome
Resolution3.4 Å
Binding residue
(original residue number in PDB)		R88 S109
Binding residue
(residue number reindexed from 1)		R31 S52
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
GO:0005829 cytosol
GO:0016607 nuclear speck
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i0p, PDBe:8i0p, PDBj:8i0p
PDBsum8i0p
PubMed39068178
UniProtQ96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein (Gene Name=SNRNP40)

[Back to BioLiP]