Structure of PDB 8hyj Chain E Binding Site BS01

Receptor Information
>8hyj Chain E (length=209) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSKYVDLSSEESHRYYLARRNGLQMLRDRGYEVSDEDINLSLHDFRTVYG
ERPDVDRLRISALHRSDSTKKVKIVFFGTSMVKVNAIRSVVADILSQETI
TGLILVLQNHVTNQALKAIELFSFKVEIFQITDLLVNITKHSLKPQHQVL
NDEEKTTLLKKFSIEEKQLPRISKKDAIVRYYGLEKGQVVKVNYRGELTE
SHVAFRCVW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hyj A cryo-EM structure of KTF1-bound polymerase V transcription elongation complex.
Resolution4.3 Å
Binding residue
(original residue number in PDB)		M94 K96
Binding residue
(residue number reindexed from 1)		M81 K83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0005515 protein binding
Biological Process
GO:0006351 DNA-templated transcription
Cellular Component
GO:0000419 RNA polymerase V complex
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hyj, PDBe:8hyj, PDBj:8hyj
PDBsum8hyj
PubMed37253723
UniProtQ9M1J2|RPE5A_ARATH DNA-directed RNA polymerase V subunit 5A (Gene Name=NRPE5A)

[Back to BioLiP]