Structure of PDB 8h0v Chain E Binding Site BS01

Receptor Information
>8h0v Chain E (length=213) Species: 460519 (Komagataella phaffii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDNNRIISRLWRSFRTVKEMAADRGYFISQEEMDQSLEEFRSKICDSMGN
PQRKLMSFLANPTPEALEKYSDLGTLWVEFCDEPSVGIKTMRNFCLRIQE
KNFSTGIFIYQNNITPSANKMIPTVSPAIIETFQESDLVVNITHHELVPK
HIRLSDGEKSQLLQRYKLKESQLPRIQREDPVARYLGLKRGQVVKIIRRS
ETSGRYASYRICL
Ligand information
>8h0v Chain N (length=201) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctttaaagcaaacggtccacttgtgtttggtgtgtttgggaatccggtgc
cgaggccgctcaattggtcgtagacagctctagcaccgcttaaacgcacg
tacgcgctgtcccccgcgttttaaccgccaaggggattactccctagtct
ccaggcacgtgtcagatatatacatccaggccttgtgtcgcgaaattcat
a
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h0v Structural basis of RNA polymerase II transcription on the chromatosome containing linker histone H1.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		G88 I89 T116 S118
Binding residue
(residue number reindexed from 1)		G87 I88 T115 S117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001054 RNA polymerase I activity
GO:0001055 RNA polymerase II activity
GO:0001056 RNA polymerase III activity
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0003968 RNA-dependent RNA polymerase activity
Biological Process
GO:0001172 RNA-templated transcription
GO:0006351 DNA-templated transcription
GO:0006360 transcription by RNA polymerase I
GO:0006361 transcription initiation at RNA polymerase I promoter
GO:0006362 transcription elongation by RNA polymerase I
GO:0006363 termination of RNA polymerase I transcription
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006368 transcription elongation by RNA polymerase II
GO:0006383 transcription by RNA polymerase III
GO:0006384 transcription initiation at RNA polymerase III promoter
GO:0006386 termination of RNA polymerase III transcription
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0042797 tRNA transcription by RNA polymerase III
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005665 RNA polymerase II, core complex
GO:0005666 RNA polymerase III complex
GO:0005736 RNA polymerase I complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8h0v, PDBe:8h0v, PDBj:8h0v
PDBsum8h0v
PubMed36435862
UniProtC4R3P8

[Back to BioLiP]