Structure of PDB 8h0i Chain E Binding Site BS01

Receptor Information
>8h0i Chain E (length=128) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MENRWQVMIVWQVDRMRINTWKRLVKHHMYISRKAKDWFYRHHYESTNPK
ISSEVHIPLGDAKLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDP
DLADQLIHLHYFPPLPSVRKLTEDRWNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h0i Structural insights into RNA bridging between HIV-1 Vif and antiviral factor APOBEC3G.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R23 Y30 H43
Binding residue
(residue number reindexed from 1)		R23 Y30 H43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019058 viral life cycle

View graph for
Biological Process
External links
PDB RCSB:8h0i, PDBe:8h0i, PDBj:8h0i
PDBsum8h0i
PubMed37419875
UniProtP12504|VIF_HV1N5 Virion infectivity factor (Gene Name=vif)

[Back to BioLiP]