Structure of PDB 8fym Chain E Binding Site BS01

Receptor Information
>8fym Chain E (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQSGTDLVRPGTSVKVSCKASGYAFTTYFIEWVKQRPGQGLEWIGV
INPGSGIPNYNEMFKGKATLTADKSSSTAYLHLSSLTSDDSAVYFCARAP
YYYGSSYYYFDVWGAGTTVTVSSASTKGPSVFPLAPSSGTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKKVEPKS
Ligand information
>8fym Chain F (length=19) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ASLWNWFNITNWLWYIKKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fym Crystal structure of Fab235 in complex with MPER peptide
Resolution2.45 Å
Binding residue
(original residue number in PDB)		F33 N52 G54 I57 N59 Y101 Y103 G104 Y107
Binding residue
(residue number reindexed from 1)		F33 N52 G54 I57 N59 Y101 Y103 G104 Y107
External links