Structure of PDB 8fyb Chain E Binding Site BS01

Receptor Information
>8fyb Chain E (length=292) Species: 906 (Megasphaera) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRATFIYIEHAKINRVDSAVTVAEAKGVVRIPAAMIGVLLLGPGTDISHR
AVELLGDTGTALVWVGEQGVRYYASGRALARSTRFLVKQAELVTNERSRL
RVARRMYQMRFPTEDVSKLTMQQLRSHEGARVRRKYRELSKKYNVPWKKR
VYNPDDFAGGDPINQALSAAHVALYGLVHSVVAALGLSPGLGFVHTGHDR
SFIYDVADLYKAEITVPIAFAVAAEAEEGQDIGQLARLRTRDAFVDGKIL
KRMVKDLQTLLEIPEEGQIEAEPLSLWDDKEKLVPYGVNYSE
Ligand information
>8fyb Chain G (length=52) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agattgagaccaggtctccgtttcatgagtctttcccgcacgagcggggg
tg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fyb Genome expansion by a CRISPR trimmer-integrase.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		H29 P62 G85 E86 R90 Y92 R144 E147 G148 V151 R152 K168 R169 Y171 P173 F176 S187 H190 Y194 H214 T215 H217 Y223 Q253 R256
Binding residue
(residue number reindexed from 1)		H10 P43 G66 E67 R71 Y73 R125 E128 G129 V132 R133 K149 R150 Y152 P154 F157 S168 H171 Y175 H195 T196 H198 Y204 Q234 R237
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 05:58:07 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8fyb', asym_id = 'E', bs = 'BS01', title = 'Genome expansion by a CRISPR trimmer-integrase.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8fyb', asym_id='E', bs='BS01', title='Genome expansion by a CRISPR trimmer-integrase.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676,0004519,0004520,0043571,0046872,0051607', uniprot = '', pdbid = '8fyb', asym_id = 'E'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0004519,0004520,0043571,0046872,0051607', uniprot='', pdbid='8fyb', asym_id='E')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>