Structure of PDB 8e73 Chain E Binding Site BS01

Receptor Information
>8e73 Chain E (length=74) Species: 157791 (Vigna radiata) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIPATVAAVKNPSSKIIYDEHNHERFPPGDPSKRAFAYFVLTGGRFVYAS
LIRLLVLKFVLSMSASKDVLALAS
Ligand information
>8e73 Chain K (length=24) Species: 157791 (Vigna radiata) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DVKAAAMWGVAAATGGLYLVQVSI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e73 Plant-specific features of respiratory supercomplex I + III 2 from Vigna radiata.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		S124 R127 L131
Binding residue
(residue number reindexed from 1)		S50 R53 L57
Enzymatic activity
Enzyme Commision number 7.1.1.8: quinol--cytochrome-c reductase.
Gene Ontology
Molecular Function
GO:0008121 ubiquinol-cytochrome-c reductase activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0051537 2 iron, 2 sulfur cluster binding
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8e73, PDBe:8e73, PDBj:8e73
PDBsum8e73
PubMed36581760
UniProtA0A1S3TB49

[Back to BioLiP]