Structure of PDB 8dtr Chain E Binding Site BS01

Receptor Information
>8dtr Chain E (length=213) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGASVKVSCQTSGYTFTSYYMHWVRQAPGQGLEWMGL
ITPSGDDTYYAQRFQGRVTMTRDTSTSPTYMELSSLTSEDTAVYYCAKMS
RAGGFDVWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH
KPSNTKVDKKVEP
Ligand information
>8dtr Chain J (length=15) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LDSFKEELDKYFKNH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dtr Rare, convergent antibodies targeting the stem helix broadly neutralize diverse betacoronaviruses.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		Y33 L50 T52 D57 Y59 M99 R101
Binding residue
(residue number reindexed from 1)		Y33 L50 T52 D57 Y59 M99 R101
External links