Structure of PDB 8d3m Chain E Binding Site BS01

Receptor Information
>8d3m Chain E (length=98) Species: 272558 (Halalkalibacterium halodurans C-125) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMLVLITYDVQTSSMGGTKRLRKVAKACQNYGQRVQNSVFECIVDSTQL
TSLKLELTSLIDEEKDSLRIYRLGNNYKTKVEHIGAKPSIDLEDPLIF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8d3m PAM binding ensures orientational integration during Cas4-Cas1-Cas2-mediated CRISPR adaptation.
Resolution3.41 Å
Binding residue
(original residue number in PDB)		Y7 V9 S12 R33 S37
Binding residue
(residue number reindexed from 1)		Y9 V11 S14 R35 S39
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8d3m, PDBe:8d3m, PDBj:8d3m
PDBsum8d3m
PubMed36272411
UniProtQ9KFX8|CAS2_HALH5 CRISPR-associated endonuclease Cas2 (Gene Name=cas2)

[Back to BioLiP]