Structure of PDB 8bx1 Chain E Binding Site BS01

Receptor Information
>8bx1 Chain E (length=77) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKR
PFIDEAKRLRALHMKEHPDYKYRPRRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bx1 Crystal structure of Oct4-Soc2-HoxB1 complex
Resolution2.5 Å
Binding residue
(original residue number in PDB)
R2 K4 R5 M11 R18 N30 Y72 R75 K77
Binding residue
(residue number reindexed from 1)
R2 K4 R5 M11 R18 N30 Y72 R75 K77
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8bx1, PDBe:8bx1, PDBj:8bx1
PDBsum8bx1
PubMed
UniProtP48432|SOX2_MOUSE Transcription factor SOX-2 (Gene Name=Sox2)

[Back to BioLiP]