Structure of PDB 8bwf Chain E Binding Site BS01

Receptor Information
>8bwf Chain E (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAA
NTMVNYYTSVTPVLRGQPIYIQFSN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bwf Rationally designed stapled peptides allosterically inhibit PTBP1-RNA-binding.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		E72 I76 L80 V85 N87 L88
Binding residue
(residue number reindexed from 1)		E15 I19 L23 V28 N30 L31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:8bwf, PDBe:8bwf, PDBj:8bwf
PDBsum8bwf
PubMed37564416
UniProtP26599|PTBP1_HUMAN Polypyrimidine tract-binding protein 1 (Gene Name=PTBP1)

[Back to BioLiP]