Structure of PDB 8bvh Chain E Binding Site BS01

Receptor Information
>8bvh Chain E (length=65) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQM
VYKHAISTVVPSRPV
Ligand information
>8bvh Chain A (length=49) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaaaauaacaacaagauuuuaaaauccagcagcaacgacaccgaacuac
.................<<<>>>..........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bvh Translational regulation by Hfq-Crc assemblies emerges from polymorphic ribonucleoprotein folding.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		Y25 G29 I30
Binding residue
(residue number reindexed from 1)		Y22 G26 I27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
GO:0009372 quorum sensing
GO:0043487 regulation of RNA stability
GO:0043609 regulation of carbon utilization
GO:0045974 regulation of translation, ncRNA-mediated
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bvh, PDBe:8bvh, PDBj:8bvh
PDBsum8bvh
PubMed36504222
UniProtQ9HUM0|HFQ_PSEAE RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]