Structure of PDB 8asl Chain E Binding Site BS01

Receptor Information
>8asl Chain E (length=44) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVTSIRYWVIHSITIPMLFIAGWLFVSTGLAYDAFGTPRPDEYF
Ligand information
>8asl Chain F (length=28) Species: 1148 (Synechocystis sp. PCC 6803) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VRWLAVHTLAVPSVFFVGAIAAMQFIQR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8asl The Ycf48 accessory factor occupies the site of the oxygen-evolving manganese cluster during photosystem II biogenesis.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		L30 F31 G34 W35 V38
Binding residue
(residue number reindexed from 1)		L18 F19 G22 W23 V26
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0030096 plasma membrane-derived thylakoid photosystem II
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8asl, PDBe:8asl, PDBj:8asl
PDBsum8asl
PubMed37542031
UniProtP09190|PSBE_SYNY3 Cytochrome b559 subunit alpha (Gene Name=psbE)

[Back to BioLiP]