Structure of PDB 8asi Chain E Binding Site BS01

Receptor Information
>8asi Chain E (length=181) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HAGTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSS
VEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAG
AEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHY
DSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Ligand information
>8asi Chain H (length=27) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WKYRYRLGGFASGALLALALAGIFSTG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8asi Cryo-EM structure of the four-subunit Rhodobacter sphaeroides cytochrome bc 1 complex in styrene maleic acid nanodiscs.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		T10 F14 Y17 A18 G21 V25
Binding residue
(residue number reindexed from 1)		T4 F8 Y11 A12 G15 V19
Enzymatic activity
Enzyme Commision number 7.1.1.8: quinol--cytochrome-c reductase.
Gene Ontology
Molecular Function
GO:0008121 ubiquinol-cytochrome-c reductase activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0051537 2 iron, 2 sulfur cluster binding
Biological Process
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8asi, PDBe:8asi, PDBj:8asi
PDBsum8asi
PubMed36913593
UniProtQ3IY09

[Back to BioLiP]