Structure of PDB 8amu Chain E Binding Site BS01

Receptor Information
>8amu Chain E (length=131) Species: 1311 (Streptococcus agalactiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKEKARYFTFLLYPESIPSDWELKLETLGVPMAISPLHDKDKSSIKGQKY
KKAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYLT
HESKDAIAKKKHVYDKADIKLINNFDIDRYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8amu Structures of pMV158 replication initiator RepB with and without DNA reveal a flexible dual-function protein.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		K3 D69 R72 K76 M86 V87
Binding residue
(residue number reindexed from 1)		K2 D68 R71 K75 M85 V86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003916 DNA topoisomerase activity
Biological Process
GO:0006260 DNA replication
Cellular Component
GO:0005727 extrachromosomal circular DNA

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8amu, PDBe:8amu, PDBj:8amu
PDBsum8amu
PubMed36688326
UniProtP13921|REPB_STRAG Replication protein RepB (Gene Name=repB)

[Back to BioLiP]