Structure of PDB 7z0o Chain E Binding Site BS01

Receptor Information
>7z0o Chain E (length=301) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETLKSANELLDSLEHSHRVDLSLHLYSAYLLKRLLYKANEKKHFYEVNQF
VKTQIKDNWTSWPNPNTIIDPSVDKLYEDIPVQPGEISNRALMHASDMMR
VELDAQWQKFLSKSALDHDVTLDVDELNIPNEISRNILVKLDSLFEGLHD
KIAKENEFDVRQDKHSNKYTYHDLVSRGCEMNEDMTDIYMKSLELYNDIP
EKYKKRKFRLPKQILKKYHQPKKTSSYLKELLSKTREDFIPVEKLLKDKR
LTSKDKSKLQRLNREETEDALNKRTFFQVKGYLEDENEISDYELDDCLIE
L
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7z0o Mechanism of RNA polymerase I selection by transcription factor UAF.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		T294 K306 K308 R309
Binding residue
(residue number reindexed from 1)		T235 K247 K249 R250
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001181 RNA polymerase I general transcription initiation factor activity
GO:0005515 protein binding
GO:0017025 TBP-class protein binding
Biological Process
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0045943 positive regulation of transcription by RNA polymerase I
Cellular Component
GO:0000500 RNA polymerase I upstream activating factor complex
GO:0005634 nucleus
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7z0o, PDBe:7z0o, PDBj:7z0o
PDBsum7z0o
PubMed35442737
UniProtP53437|RRN9_YEAST RNA polymerase I-specific transcription initiation factor RRN9 (Gene Name=RRN9)

[Back to BioLiP]