Structure of PDB 7y6c Chain E Binding Site BS01

Receptor Information
>7y6c Chain E (length=77) Species: 1263550 (Edwardsiella piscicida) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSVPHLVVEAGFAAVNCGMRAEMHDILNALPDWLDDPDQVTRCEAILLFG
LGRQRAAAARLAMLPPDDCLPLRALLT
Ligand information
>7y6c Chain F (length=18) Species: 1263550 (Edwardsiella piscicida) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SVMKTVKDMMMSIISKIG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y6c Secreted in a Type III Secretion System-Dependent Manner, EsaH and EscE Are the Cochaperones of the T3SS Needle Protein EsaG of Edwardsiella piscicida.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		S5 H8 E12 F15 Q42 I49 C72 P74 L75 L78
Binding residue
(residue number reindexed from 1)		S2 H5 E9 F12 Q39 I46 C69 P71 L72 L75
External links