Structure of PDB 7xn7 Chain E Binding Site BS01

Receptor Information

>7xn7 Chain E (length=213) Species: 460519 (Komagataella phaffii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EDNNRIISRLWRSFRTVKEMAADRGYFISQEEMDQSLEEFRSKICDSMGN
PQRKLMSFLANPTPEALEKYSDLGTLWVEFCDEPSVGIKTMRNFCLRIQE
KNFSTGIFIYQNNITPSANKMIPTVSPAIIETFQESDLVVNITHHELVPK
HIRLSDGEKSQLLQRYKLKESQLPRIQREDPVARYLGLKRGQVVKIIRRS
ETSGRYASYRICL

Ligand information

>7xn7 Chain N (length=42) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tttctgtctcgtgcctggtaatccccttggcggttaaaacgc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7xn7 Structural basis of nucleosome disassembly and reassembly by RNAPII elongation complex with FACT.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	I89 S118
Binding residue (residue number reindexed from 1)	I88 S117

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0001054	RNA polymerase I activity
GO:0001055	RNA polymerase II activity
GO:0001056	RNA polymerase III activity
GO:0003677	DNA binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006360	transcription by RNA polymerase I
GO:0006366	transcription by RNA polymerase II
GO:0006383	transcription by RNA polymerase III

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005665	RNA polymerase II, core complex
GO:0005666	RNA polymerase III complex
GO:0005736	RNA polymerase I complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7xn7, PDBe:7xn7, PDBj:7xn7
PDBsum	7xn7
PubMed	35981082
UniProt	F2QX94

[Back to BioLiP]