Structure of PDB 7vd5 Chain E Binding Site BS01

Receptor Information
>7vd5 Chain E (length=75) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPFSDIITSVRYWIIHSITIPSLFVSGWLFISTGLAYDVFGTPRPNEYFT
QDRQQVPLVNDRFSAKQELEDLTKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vd5 Structural basis for different types of hetero-tetrameric light-harvesting complexes in a diatom PSII-FCPII supercomplex
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R9 L31 F32 S34 G35 W36 F38 I39
Binding residue
(residue number reindexed from 1)		R1 L23 F24 S26 G27 W28 F30 I31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vd5, PDBe:7vd5, PDBj:7vd5
PDBsum7vd5
PubMed
UniProtA0A679C209

[Back to BioLiP]