Structure of PDB 7uzz Chain E Binding Site BS01

Receptor Information

>7uzz Chain E (length=293) Species: 176279 (Staphylococcus epidermidis RP62A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KNYEVVIKTLGPIHIGSGQVMKKQDYIYDFYNSKVYMINGNKLVKFLKRK
NLLYTYQNFLRYPPKNPRENGLKDYLDAQNVKQSEWEAFVSYSEKLNDLH
LMVRDGQNKVYLPGSSIKGAIKTTLVSKYNNEKNKDIYSKIKVSDSKPID
ESNLAIYQKIDINKSEKSMPLYRECIDVNTEIKFKLTIEDEIYSINEIEQ
SIQDFYKNYYDKWLVGFKETKGGRRFALEGGIPDVLNQNILFLGAGTGFV
SNRKQAKQDSFEILTKMKEALKGTTNQSRHTSYQQGMCKVSFQ

Ligand information

>7uzz Chain G (length=30) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acgagaacacguaugccgaaguauauaaau

..............................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7uzz Structures of an active type III-A CRISPR effector complex.
Resolution	4.45 Å
Binding residue (original residue number in PDB)	Y155 S156
Binding residue (residue number reindexed from 1)	Y138 S139

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0051607	defense response to virus

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7uzz, PDBe:7uzz, PDBj:7uzz
PDBsum	7uzz
PubMed	35714601
UniProt	Q5HK93

[Back to BioLiP]