Structure of PDB 7txc Chain E Binding Site BS01

Receptor Information
>7txc Chain E (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRPFKCSVCEKTYKDPATLRQHEKTHWLTRPFPCNICGKMFTQRGTMTRH
MRSHLGLKPFACDECGMRFTRQYRLTEHMRVHSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7txc HIC2 controls developmental hemoglobin switching by repressing BCL11A transcription.
Resolution3.04 Å
Binding residue
(original residue number in PDB)
Y514 Q522 R545 R550 Y574
Binding residue
(residue number reindexed from 1)
Y13 Q21 R44 R49 Y73
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7txc, PDBe:7txc, PDBj:7txc
PDBsum7txc
PubMed35941187
UniProtQ96JB3|HIC2_HUMAN Hypermethylated in cancer 2 protein (Gene Name=HIC2)

[Back to BioLiP]