Structure of PDB 7tt7 Chain E Binding Site BS01

Receptor Information
>7tt7 Chain E (length=89) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNT
WFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALS
Ligand information
>7tt7 Chain C (length=28) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DEAYLEAAPLAELHAPALPVTSGDYAIP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tt7 Cryo-EM structures reveal multiple stages of bacterial outer membrane protein folding.
Resolution4.8 Å
Binding residue
(original residue number in PDB)		P67 F68
Binding residue
(residue number reindexed from 1)		P45 F46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:1901612 cardiolipin binding
Biological Process
GO:0043165 Gram-negative-bacterium-type cell outer membrane assembly
GO:0046677 response to antibiotic
GO:0051205 protein insertion into membrane
Cellular Component
GO:0009279 cell outer membrane
GO:0016020 membrane
GO:0019867 outer membrane
GO:1990063 Bam protein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7tt7, PDBe:7tt7, PDBj:7tt7
PDBsum7tt7
PubMed35294859
UniProtP0A937|BAME_ECOLI Outer membrane protein assembly factor BamE (Gene Name=bamE)

[Back to BioLiP]