Structure of PDB 7tan Chain E Binding Site BS01

Receptor Information
>7tan Chain E (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>7tan Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggatgtatatatctgacacgtgcctggagactagggagtaatccccttgg
cggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctagag
ctgtctacgaccaattgagcggcctcggcaccgggattctccagggc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tan Multivalent DNA and nucleosome acidic patch interactions specify VRK1 mitotic localization and activity.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R40 V46 R49 R69
Binding residue
(residue number reindexed from 1)		R3 V9 R12 R32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7tan, PDBe:7tan, PDBj:7tan
PDBsum7tan
PubMed35390161
UniProtQ71DI3|H32_HUMAN Histone H3.2 (Gene Name=H3C15)

[Back to BioLiP]