Structure of PDB 7t2a Chain E Binding Site BS01

Receptor Information
>7t2a Chain E (length=177) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELG
RPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPS
NLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLE
MTPQQGDVYTCQVEHTSLDSPVTVEWK
Ligand information
>7t2a Chain F (length=12) Species: 1313 (Streptococcus pneumoniae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TGLAWEWWRTVY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7t2a CD4 + T cell-mediated recognition of a conserved cholesterol-dependent cytolysin epitope generates broad antibacterial immunity.
Resolution3.04 Å
Binding residue
(original residue number in PDB)		G11 Q13 E28 Y30 P56 W61 I67 E70 K71 V74 R77 M78 H81 N82 L85
Binding residue
(residue number reindexed from 1)		G9 Q11 E24 Y26 P52 W57 I63 E66 K67 V70 R73 M74 H77 N78 L81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7t2a, PDBe:7t2a, PDBj:7t2a
PDBsum7t2a
PubMed37100059
UniProtP04440|DPB1_HUMAN HLA class II histocompatibility antigen, DP beta 1 chain (Gene Name=HLA-DPB1)

[Back to BioLiP]