Structure of PDB 7ssa Chain E Binding Site BS01

Receptor Information
>7ssa Chain E (length=91) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMAL
QEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Ligand information
>7ssa Chain I (length=137) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcacgtgaccaggccgctcaattggtcgtagacagctctagcaccgctta
aacgcacgtacgcgctgtcccccgcgttttaaccgccaaggggattactc
cctagtctccagggacgtctcagatatatacatcctg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ssa Basic helix-loop-helix pioneer factors interact with the histone octamer to invade nucleosomes and generate nucleosome-depleted regions.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		G44 V46 A47 R63 K64 L65 R69 R83
Binding residue
(residue number reindexed from 1)		G2 V4 A5 R21 K22 L23 R27 R41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7ssa, PDBe:7ssa, PDBj:7ssa
PDBsum7ssa
PubMed36996811
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]