Structure of PDB 7sfy Chain E Binding Site BS01

Receptor Information
>7sfy Chain E (length=31) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRVEIEKSLTQMEDVLKALQMKLWEAESKLS
Ligand information
>7sfy Chain D (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VEIEKSLTQMEDVLKALQMKLWEAESKLS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sfy Structural Basis for Mis18 Complex Assembly: Implications for Centromere Maintenance
Resolution2.5 Å
Binding residue
(original residue number in PDB)		S204 M208 L215 L219
Binding residue
(residue number reindexed from 1)		S8 M12 L19 L23
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7sfy, PDBe:7sfy, PDBj:7sfy
PDBsum7sfy
PubMed
UniProtQ9NYP9|MS18A_HUMAN Protein Mis18-alpha (Gene Name=MIS18A)

[Back to BioLiP]