Structure of PDB 7rm4 Chain E Binding Site BS01

Receptor Information
>7rm4 Chain E (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIEQNSEALNIQEGKTATLTCNYTNYSPAYLQWYRQDPGRGPVFLLLIRE
NEKEKRKERLKVTFDTTLKQSLFHITASQPADSATYLCALDIYPHDMRFG
AGTRLTVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSD
VYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rm4 T cell receptors employ diverse strategies to target a p53 cancer neoantigen.
Resolution3.33 Å
Binding residue
(original residue number in PDB)
D93 Y95 P96
Binding residue
(residue number reindexed from 1)
D91 Y93 P94
External links