Structure of PDB 7rf5 Chain E Binding Site BS01

Receptor Information

>7rf5 Chain E (length=82) Species: 197221 (Thermosynechococcus vestitus BP-1)

GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRP
DSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK

Ligand information

>7rf5 Chain R (length=28) Species: 197221 (Thermosynechococcus vestitus BP-1)

DWRVLVVLLPVLLAAGWAVRNILPYAVK

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7rf5 Structural dynamics in the water and proton channels of photosystem II during the S 2 to S 3 transition.
• Resolution: 2.23 Å
• Binding residue (original residue number in PDB): R18 V21 I22 I25 A29 A33 L36 F37 G41 L42 D45
• Binding residue (residue number reindexed from 1): R16 V19 I20 I23 A27 A31 L34 F35 G39 L40 D43

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0005737 cytoplasm
• GO:0009523 photosystem II
• GO:0009539 photosystem II reaction center
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:7rf5, PDBe:7rf5, PDBj:7rf5
• PDBsum: 7rf5
• PubMed: 34764256
• UniProt: Q8DIP0|PSBE_THEVB Cytochrome b559 subunit alpha (Gene Name=psbE)