Structure of PDB 7r0w Chain E Binding Site BS01

Receptor Information
>7r0w Chain E (length=32) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAAGVGIFIGYIAVFTGVTLGLLYGLRFVKLI
Ligand information
>7r0w Chain H (length=29) Species: 1148 (Synechocystis sp. PCC 6803) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MDILTLGWVSVLVLFTWSISMVVWGRNGF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r0w Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		G4 I7 F8 Y11 F15 T19
Binding residue
(residue number reindexed from 1)		G4 I7 F8 Y11 F15 T19
External links