Structure of PDB 7q3o Chain E Binding Site BS01

Receptor Information
>7q3o Chain E (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWF
QNRRAKERKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q3o Structure of CDX1 bound to hydroxymethylated DNA
Resolution2.78 Å
Binding residue
(original residue number in PDB)
T185 K186 R190 V191 Y193 R198 R228 Q229 I232 N236 K240
Binding residue
(residue number reindexed from 1)
T1 K2 R6 V7 Y9 R14 R44 Q45 I48 N52 K56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:7q3o, PDBe:7q3o, PDBj:7q3o
PDBsum7q3o
PubMed
UniProtP47902|CDX1_HUMAN Homeobox protein CDX-1 (Gene Name=CDX1)

[Back to BioLiP]