Structure of PDB 7oue Chain E Binding Site BS01

Receptor Information
>7oue Chain E (length=242) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMIARIIGEIGIEGARFIEENIDEQFKALRYLSKGIDSETFVKLVIAN
SLVSYQLTGKGEQWWWEFAKYFYGRDVKSIYLAYKEFLPNSRFNRRLIPQ
KLSRIRRVETFLSTLTEERIEEYYGDMSSLWGSIARALGVDKESKTVVFS
VKMFGYAARIVLSTFNPYPMEIPIPEDSRIVKLTKKLTNEKPRKFWMKIA
RESGVPPLHIDSILWPLLGGASIDSAPPELRDKLAELIKIIR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oue Structural and functional determinants of the archaeal 8-oxoguanine-DNA glycosylase AGOG for DNA damage recognition and processing.
Resolution2.04 Å
Binding residue
(original residue number in PDB)		Y52 Q53 L54 T55 G56 R93 Q97 R101 R104 V137 K142 T143 D174
Binding residue
(residue number reindexed from 1)		Y55 Q56 L57 T58 G59 R96 Q100 R104 R107 V140 K145 T146 D177
Enzymatic activity
Enzyme Commision number 3.2.2.-
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
Gene Ontology
Molecular Function
GO:0000702 oxidized base lesion DNA N-glycosylase activity
GO:0003824 catalytic activity
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0016787 hydrolase activity
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0016829 lyase activity
GO:0140078 class I DNA-(apurinic or apyrimidinic site) endonuclease activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7oue, PDBe:7oue, PDBj:7oue
PDBsum7oue
PubMed36300625
UniProtQ9UZY0|AGOG_PYRAB N-glycosylase/DNA lyase (Gene Name=PYRAB10170)

[Back to BioLiP]