Structure of PDB 7ogs Chain E Binding Site BS01

Receptor Information
>7ogs Chain E (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAA
LFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDIS
DPYKVYRIVPEGAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ogs X-ray Structure of Interferon Regulatory Factor 4 DNA binding domain bound to interferon-stimulated response element
Resolution2.37 Å
Binding residue
(original residue number in PDB)		G22 K23 L24 H56 K78 K80 R96 C99
Binding residue
(residue number reindexed from 1)		G3 K4 L5 H37 K59 K61 R77 C80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7ogs, PDBe:7ogs, PDBj:7ogs
PDBsum7ogs
PubMed
UniProtQ15306|IRF4_HUMAN Interferon regulatory factor 4 (Gene Name=IRF4)

[Back to BioLiP]