Structure of PDB 7o3t Chain E Binding Site BS01

Receptor Information
>7o3t Chain E (length=115) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDVPSSSRYDHRIRYVTYNPADVVQVDTVLGVATHIMLEEGEQYLTHAFG
DSEAYAFARKGRHIFIKPQAELANTNLIVVTDRRSYKFRLQMRNDRNGAM
YELAFRYPDTQARQT
Ligand information
>7o3t Chain D (length=19) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KTPYELARERMLRSGLTAG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o3t Cryo-EM structure of a type IV secretion system.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
H67 F69 D71 S72 E73 A90 E91
Binding residue
(residue number reindexed from 1)
H47 F49 D51 S52 E53 A70 E71
Enzymatic activity
Enzyme Commision number ?
External links