Structure of PDB 7mi5 Chain E Binding Site BS01

Receptor Information
>7mi5 Chain E (length=95) Species: 243231 (Geobacter sulfurreducens PCA) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEHLYIVSYDIRNQRRWRRLFKTMHGFGCWLQLSVFQCRLDRIRIIKMEA
AINEIVNHAEDHVLILDLGPAENVKPKVSSIGKTFDPILRQAVIV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7mi5 Mechanism for Cas4-assisted directional spacer acquisition in CRISPR-Cas.
Resolution3.57 Å
Binding residue
(original residue number in PDB)		R18 L33
Binding residue
(residue number reindexed from 1)		R18 L33
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0008150 biological_process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7mi5, PDBe:7mi5, PDBj:7mi5
PDBsum7mi5
PubMed34588691
UniProtQ74H35|CAS2_GEOSL CRISPR-associated endoribonuclease Cas2 (Gene Name=cas2)

[Back to BioLiP]